Questions and answers categories > 587

English, 29.09.2020 04:01, joviecar

My father works abroad, but he promised that hereturn home on my graduation day. a. can b. may c. must d. will...

Music, 29.09.2020 04:01, lhadyclaire

6. The music note's placement in the staff shows what kind of melody?...

English, 29.09.2020 04:01, snow01

examples of paragraph using progressive aspects of verbs,in how politeness and friendship can be observed at all times?...

Filipino, 29.09.2020 04:01, Grakname

Ano ang tawag sa grupo ng taludturan sa tula...

Science, 29.09.2020 04:01, abbigail333

The line of action is the straight line passing through the point of application and is...

Araling Panlipunan, 29.09.2020 04:01, shannel99

Ano-ano ang mga salik ng pag-usbong ng damdaming nasyonalismong pilipino...

Religion, 29.09.2020 04:01, ShairaGailSanchez

Reflection about the bible verse Luke 11:28...

Religion, 29.09.2020 04:01, jemuelpogi

Why do you think the Bible was given to us, to what purpose the bible is written?...

Math, 29.09.2020 04:01, camillebalajadia

What new realizations do you have about finding the nth term of arithmetic sequence and finding the arithmetic means? How eould you use this in making...

History, 29.09.2020 04:01, tayis

Why African poetry often recited to a singsong voice ? How it is related to their culture?...

English, 29.09.2020 04:01, reyquicoy4321

What are the concepts of power, politics, justice and governance of Aristotle...

World Languages, 29.09.2020 04:01, RoseTheShadowHunter

What were your misconceptions about the topic (communication) prior to taking up this lesson? What new or additional learning have you gained from th...

Filipino, 29.09.2020 04:01, molinamaureen080693

Kawani an9ng ibig sabihin nito...

Chemistry, 29.09.2020 04:01, 123gra

Draw complete Lewis structures for the following condensed structural formulas.(a) CH3(CH2)3CH(CH3)2(b) (CH3)2CHCH2C1(c) CH3CH2COCH...

Technology and Home Economics, 29.09.2020 04:01, kirbydimaranan

Is one form of discourse superior to the others?Or do they complement each other?...

Math, 29.09.2020 04:01, snow01

there are ( 1 ) __ ways finding general rule or nth term of a given sequence As I go through this topic I learned that different sequence can be solve...

English, 29.09.2020 04:01, jemuelpogi

It refers how ones membership to a particular race affects....

Math, 29.09.2020 04:01, Grakname

Pa ano po ito find the g.c.f .then,expess each fraction into lowest terms.

Science, 29.09.2020 04:01, hellcrack777

How do cells transform, store, and use energy to maintain the survival of organisms?...

Filipino, 29.09.2020 04:01, cland123

8. Toilsomely means...

Integrated Science, 29.09.2020 04:01, snow01

Difference between artificial classification and natural classification?...

Math, 29.09.2020 04:01, kateclaire

Find the gcf.then express each fraction in to lowest termspa ano po ito

English, 29.09.2020 04:01, cland123

English rap about covid19? ...

Math, 29.09.2020 04:01, 09330399672

Fatima borrowed money from your mother with an interest is 10%.Fatima is a best friend of your mother . What is you stand about this?...

Physical Education, 29.09.2020 04:01, brianneaudreyvuy

PARTE KANO ti balay da roma?...

Math, 29.09.2020 04:01, axelamat70

An object is thrown upward from the top of a 200 - foot cliff with a velocity of 12 feet per second. The height h in feet of the object after t second...

Economics, 29.09.2020 04:01, camillebalajadia

1. How are social facts related to social science? 2. How can social studies make an individual a well-informed and a rational citizen? 3. What...

Araling Panlipunan, 29.09.2020 04:01, aimeedelacruz24

Gumagawa ng isang ekonomikong pagpapasya ang isang tao araw-araw. Bakit mahalagang maunawaan ng isang mag-aaral ang kaalaman sa ekonomiks bilang bahag...

Araling Panlipunan, 29.09.2020 04:01, princessgarcia23

6. Ito ang uri ng lahi sa daigdig na may pinakamalaking bilang. A. African-American B. BlackC. Caucasian D. Mo7. Ang kabuhayan ng mga sin...

English, 29.09.2020 04:01, kuanjunjunkuan

What are the components of physical fitness test and its meaning...

Physical Education, 29.09.2020 04:01, sherelyn0013

Does modern dance catch your attention? Why? ...

Computer Science, 29.09.2020 04:01, brianneaudreyvuy

A computer network is composed of two or more computers that shares information and resources....

Health, 29.09.2020 04:01, ian2145

this refers to why and how people eat,which foods they eat ,and with whom they eat as well as the ways people collect store ,use and discard food?...

Math, 29.09.2020 04:01, 20201947

What part of the 105kg of potatoes are 5 kg bags?...

Filipino, 29.09.2020 04:01, cyrishlayno

Mabuting kasama ang taong marunong tumanaw ng utang na loob...

Geography, 29.09.2020 04:01, stacy05

What is the best movie you have seen ....

Araling Panlipunan, 29.09.2020 04:01, princessgarcia23

Sino ang namuno sa kilusang itinatag ng mga paring Pilipino,,...

Geography, 29.09.2020 04:01, nelgelinagudo

A literature influenced by the spanish...

English, 29.09.2020 04:01, ShairaGailSanchez

how do you assess this words terrorist pretty gay are you assessments based on unfounded generalization or facts...

Science, 29.09.2020 04:01, 20201947

1. What do you think will happen if the lungs and the heart stopped working together?...

Araling Panlipunan, 29.09.2020 04:01, meteor13

Ano ang gagawin mo kung ikaw ay nakasakay sa jeep at biglang lumindol?...

History, 29.09.2020 04:01, nelspas422

why is it important for the government to upload the rights of the people? is the government the only entity with the responsibility of upholding huma...

English, 29.09.2020 04:01, jemuelpogi

Express your feelings about your loving country/nation...

Math, 29.09.2020 04:01, snow01

LetB =even natural numbers less than 12...

Computer Science, 29.09.2020 04:01, shannel99

Computers are the persinal pc is designed for use by an individual at fixed a loaction....

Physical Education, 29.09.2020 04:01, joyce5512

How significant is active sports participation in our family/community...

Technology and Home Economics, 29.09.2020 04:01, sicienth

Pamantayn Kaangkupan ng konsepto Pagkakamalikhain Kompleto ang detalye/nilalaman Ang ideya ay orihinal...

Filipino, 29.09.2020 04:01, RoseTheShadowHunter

What is manifested in tagalog...

Math, 29.09.2020 04:01, girly61

Verbal StatementSet R is a set whoseelements are evenpositive integersless than ten...

History, 29.09.2020 04:01, 09330399672

1. Bakit mahalaga ang pagtataya ng pagkatotoo at kredibilidad ng bawat dokumento?...

English, 29.09.2020 04:01, calmaaprilgrace

Anthropometric measurement are use to measure the body measurement. Choose among the set of equipment use to measure body mass index....

Edukasyon sa Pagpapakatao, 29.09.2020 04:01, maledabacuetes

Sa panahon ng pandemya, paano napapakita ng mga pilipino ang pagkakaisa?...

Filipino, 29.09.2020 04:01, Axelamat

Ito ay maliit na hayop na nahahawig sa usa at kabilang sa mga 'endangered species'...

English, 29.09.2020 04:01, stacy05

Exercise 2. Google It! Using the internet, look for more information about the given words that reflect culture. Listkey ideas about them and c...

English, 29.09.2020 04:01, kuanjunjunkuan

5. How will you use communication to contribute something to the world especially during this time of pandemic?...

Araling Panlipunan, 29.09.2020 04:01, kenn14

Pilipinas?Ang pag lobo ng pupulasyon sa...

Filipino, 29.09.2020 04:01, jemuelpogi

Stors is (X + Who is the other factor?binomial x2 - 64, one of thea, x + 8b. x - 8c. x - 32d. x + 32...

Filipino, 29.09.2020 04:01, villatura

sa limang pangungusap paano mo ilalarawan ang buhay ng mga asyano kung naubos na ang yamang likas na mayroon dito...

Math, 29.09.2020 04:01, cbohol56

If (m-t)(B)=m³-t³,then which of the following statement is true about G and H...

Technology and Home Economics, 29.09.2020 04:01, kelly072

Four paragraph essay on how covid 19 affects the mental health of people incorporate intensive and reflexive pronoun in your writing. english sub to...

Health, 29.09.2020 04:01, RoseTheShadowHunter

Short - term effects ofstimulants...

Science, 29.09.2020 04:01, meteor13

Explain why having enough rest can promote overall health of our skin....

Edukasyon sa Pagpapakatao, 29.09.2020 04:01, cleik

Marahil binibigyan ko lang nang katwiran ang kahihinatnan nga hindi ko pagbabalik aral ng leksiyon ...

Science, 29.09.2020 04:01, snow01

What are the negative lifestyles of people in your community that you frequently observed?...

Araling Panlipunan, 29.09.2020 04:01, tayis

Bumuo ng slogan na nagpapakiya ng kahalagahan ng kontemporaryong isyu....

Technology and Home Economics, 29.09.2020 04:01, JUMAIRAHtheOTAKU

It is a receptacle for holding dirt, trash and other throw away...

Araling Panlipunan, 29.09.2020 04:01, alexespinosa

Sa iyong palagay, ang klima ba ng Pilipinas ay tama lamang sa pang-araw-araw na pamumuhay ng mga tao? Bakit?...

Science, 29.09.2020 04:01, jemuelpogi

On the other parts that you identified why do you believe these part are involved in breathing?...

Religion, 29.09.2020 04:01, Axelamat

Do you want to study Philosophy? Why?...

Technology and Home Economics, 29.09.2020 04:01, rhaineandreirefuerzo

1.)How many gallons of water are there in a 10 A x 5ft tank with 2 inches depth? (refer example on page 486) (3 points). 2.)How many gallons of water...

Math, 29.09.2020 04:01, taekookislifeu

Supply the missing term x² -? +49...

English, 29.09.2020 04:01, kambalpandesal23

Explain the relevance of studying history particularly phillippine history...

Filipino, 29.09.2020 04:01, enrica11

Kailan masasabi na ang pangngalan ay nasa kaukulang palagyo???...

History, 29.09.2020 04:01, kateclaire

Explain the process of multiperspectivity...

English, 29.09.2020 04:01, christiandumanon

There's a lot of noise coming from the hallway. _ I close the window?...

Filipino, 29.09.2020 04:01, cyrishlayno

Panimulang pag-aaral o proposal, ito ay sa kabuuan ng ideyangbnabuo mula sa isang balangkas o framework....

Filipino, 29.09.2020 04:01, kenn14

Magbigay ng pangungusap na mula sa Alamat ng Sampaguita na nagpapakita na paraan ng paglalahad ng pananaw...

Araling Panlipunan, 29.09.2020 04:01, janalynmae

Ano kahalagahannglikasnayamansapang-araw-arawnapamumuhayng manoya...

Science, 29.09.2020 04:01, hannahleigh

9. The actual temperature of a tea is 78⁰C. Ben used a thermometer and measured the coffee’s temperature, the result is 83⁰C. What is percentage error...

Filipino, 29.09.2020 04:01, joviecar

Ano sa palagay mo ang kalamangan at kawalan ng paggamit ng retorika sa panahon ng teknolohiya?...

Math, 29.09.2020 04:01, abbigail333

How did the speaker describe the "YOU" in the poem?given as many description as possible...

Health, 29.09.2020 04:01, tayis

Short term effect of depressants...

Computer Science, 29.09.2020 04:01, camillebalajadia

to avoid disruption to other student what should you use while watching a video tutorial on installing a system software...

Religion, 29.09.2020 04:01, sicienth

Think of the characteristics of Jesus as a person. Use the letters of the name: "JESUS" in coming up with the characteristics of Jesus.J-...

Math, 29.09.2020 04:01, dorothy13

1. 2/6 + 2/4 =n? 2. 1 1/6 + 1/3=n? 3. 2/5 + 1/2=n? 4. 1 1/4 + 1 1/3=n? 5. 1/7 + 3/5=n? (without solution)...

Araling Panlipunan, 29.09.2020 04:01, aimeedelacruz24

Lokasyong insular ng brazil...

Science, 29.09.2020 04:01, abbigail333

Best describes a scientest?...

Filipino, 29.09.2020 04:01, shannel99

Paanomo ilalarawan ang iyong puso bilang isang mananampalataya? ipaliwanag ang iyong sagot...

Edukasyon sa Pagpapakatao, 29.09.2020 04:01, 123gra

Ano ang pagkakatulad ng HAYOP AT TAO Ano ang pagkakaiba ng HAYOP AT TAO Paano kumilos ang HAYOP AT TAO...

English, 29.09.2020 04:01, kuanjunjunkuan

How did the speaker describe the "YOU" in the poem?given as many description as possible...

Art, 29.09.2020 04:01, lhadyclaire

In what way you can art in advertising the resiliency of the filipinos in facing hardship...

Science, 29.09.2020 04:01, Axelamat

Can; -soil mixed with water be identified? -aluminum mixed with water be identified? -newspaper mixed with water be identified? -so...

Physical Education, 29.09.2020 04:01, abyzwlye

What are some common injuries that may happen during a sport officiating activity...

Araling Panlipunan, 29.09.2020 04:01, kuanjunjunkuan

PAANO NA IIMPLUWENSYAHAN NG PILOSOPIYA AT TEOLOHIYA ANG MGA PAGPAPASIYA NG TAO NA MAY KINALAMAN SA EKONOMIKS? MAGBIGAY NG KONKRETONG HALIMBAWA pleas...

Math, 29.09.2020 04:01, hannahleigh

Based on the financial statements of ABC business firm, the total sales of ABC reached 3,000,000.00. It also generated total investments of 2,000,000....

World Languages, 29.09.2020 04:01, nicole8678

There willbe a music concert next to vienna coffee shop. would you like to go...

Religion, 29.09.2020 04:01, sicienth

Please make a letter for teachers day and make it nice...

Technology and Home Economics, 29.09.2020 04:01, girly61

It is a receptacle for holding dirt, trash and other throw away...

Science, 29.09.2020 04:01, aimeedelacruz24

An object is accelerated at a rate if 5m/s2.find the mass of the object if the force exerted on it is 4x10⁵ dynes...

Filipino, 29.09.2020 04:01, sicienth

Ano ang ibig sabihin ng salitang masuyong...